Assessment of black cumin (Nigella sativa L.) as a food ingredient and putative therapeutic agent
Regul Toxicol Pharmacol. 2021 Nov 25:105088. doi: 10.1016/j.yrtph.2021.105088. Online ahead of print.ABSTRACTThe whole or ground seeds of the food ingredient Nigella sativa L., known in Western culture as "black cumin" or "black caraway", has a three-millennial history of use in Middle- and Far-Eastern cultures as a food ingredient. The seed and its extracts have also been increasingly reported as a successful therapeutic agent with efficacy often attributed to the presence of the powerful antioxidant, thymoquinone. However, quantitative analysis of the seed (especially the volatile fraction) yields widely variable results...
Source: Regulatory Toxicology and Pharmacology : RTP - November 28, 2021 Category: Toxicology Authors: George A Burdock Source Type: research
Assessment of black cumin (Nigella sativa L.) as a food ingredient and putative therapeutic agent
Regul Toxicol Pharmacol. 2021 Nov 25:105088. doi: 10.1016/j.yrtph.2021.105088. Online ahead of print.ABSTRACTThe whole or ground seeds of the food ingredient Nigella sativa L., known in Western culture as "black cumin" or "black caraway", has a three-millennial history of use in Middle- and Far-Eastern cultures as a food ingredient. The seed and its extracts have also been increasingly reported as a successful therapeutic agent with efficacy often attributed to the presence of the powerful antioxidant, thymoquinone. However, quantitative analysis of the seed (especially the volatile fraction) yields widely variable results...
Source: Regulatory Toxicology and Pharmacology : RTP - November 28, 2021 Category: Toxicology Authors: George A Burdock Source Type: research
Assessment of black cumin (Nigella sativa L.) as a food ingredient and putative therapeutic agent
Regul Toxicol Pharmacol. 2021 Nov 25:105088. doi: 10.1016/j.yrtph.2021.105088. Online ahead of print.ABSTRACTThe whole or ground seeds of the food ingredient Nigella sativa L., known in Western culture as "black cumin" or "black caraway", has a three-millennial history of use in Middle- and Far-Eastern cultures as a food ingredient. The seed and its extracts have also been increasingly reported as a successful therapeutic agent with efficacy often attributed to the presence of the powerful antioxidant, thymoquinone. However, quantitative analysis of the seed (especially the volatile fraction) yields widely variable results...
Source: Regulatory Toxicology and Pharmacology : RTP - November 28, 2021 Category: Toxicology Authors: George A Burdock Source Type: research
Pesticide residues in honeybee-collected pollen: does the EU regulation protect honeybees from pesticides?
Environ Sci Pollut Res Int. 2021 Oct 23. doi: 10.1007/s11356-021-16947-z. Online ahead of print.ABSTRACTResearchers globally identify pesticides as one of the main reasons for pollinator decline. In the European Union (EU), extensive legislation is implemented to protect pollinators from harmful pesticide exposure. The aim of our study was to discover whether the pesticide residue levels in honeybee matrices, such as nectar and pollen, exceeded the chronic or acute toxicity levels when beehives were located next to fields treated with specific insecticides. The insecticides were used according to the EU legislation and its...
Source: Environmental Science and Pollution Research International - October 24, 2021 Category: Environmental Health Authors: Lotta Kaila Jarmo Ketola Marjaana Toivonen Olli Loukola Kati Hakala Sakari Raiskio Timo Hurme Marja Jalli Source Type: research
Mechanistic investigations on antifungal and antiaflatoxigenic activities of chemically characterised < em > Carum carvi < /em > L. essential oil against fungal infestation and aflatoxin contamination of herbal raw materials
This study aimed to investigate the efficiency of chemically characterised Carum carvi essential oil (CcEO) against aflatoxin B1 (AFB1) producing strain of Aspergillus flavus (AF-LHP-WS-4) causing deterioration of herbal raw materials (HRM). GC-MS analysis of the EO revealed the presence of carvone (69.85%) as a dominant component. CcEO caused complete suppression of A. flavus growth and AFB1 secretion at 0.7 and 0.6 µL/mL, respectively. The investigation on antifungal mode of action showed that CcEO inhibited fungal growth via abrogating ergosterol biosynthesis and triggered efflux of vital cellular ions. The inhibition ...
Source: Natural Product Research - October 21, 2021 Category: Biochemistry Authors: Akash Maurya Susheel Kumar Bijendra Kumar Singh Anand Kumar Chaudhari Abhishek Kumar Dwivedy Bhanu Prakash Nawal Kishore Dubey Source Type: research
Mechanistic investigations on antifungal and antiaflatoxigenic activities of chemically characterised < em > Carum carvi < /em > L. essential oil against fungal infestation and aflatoxin contamination of herbal raw materials
This study aimed to investigate the efficiency of chemically characterised Carum carvi essential oil (CcEO) against aflatoxin B1 (AFB1) producing strain of Aspergillus flavus (AF-LHP-WS-4) causing deterioration of herbal raw materials (HRM). GC-MS analysis of the EO revealed the presence of carvone (69.85%) as a dominant component. CcEO caused complete suppression of A. flavus growth and AFB1 secretion at 0.7 and 0.6 µL/mL, respectively. The investigation on antifungal mode of action showed that CcEO inhibited fungal growth via abrogating ergosterol biosynthesis and triggered efflux of vital cellular ions. The inhibition ...
Source: Natural Product Research - October 21, 2021 Category: Biochemistry Authors: Akash Maurya Susheel Kumar Bijendra Kumar Singh Anand Kumar Chaudhari Abhishek Kumar Dwivedy Bhanu Prakash Nawal Kishore Dubey Source Type: research
Mechanistic investigations on antifungal and antiaflatoxigenic activities of chemically characterised < em > Carum carvi < /em > L. essential oil against fungal infestation and aflatoxin contamination of herbal raw materials
This study aimed to investigate the efficiency of chemically characterised Carum carvi essential oil (CcEO) against aflatoxin B1 (AFB1) producing strain of Aspergillus flavus (AF-LHP-WS-4) causing deterioration of herbal raw materials (HRM). GC-MS analysis of the EO revealed the presence of carvone (69.85%) as a dominant component. CcEO caused complete suppression of A. flavus growth and AFB1 secretion at 0.7 and 0.6 µL/mL, respectively. The investigation on antifungal mode of action showed that CcEO inhibited fungal growth via abrogating ergosterol biosynthesis and triggered efflux of vital cellular ions. The inhibition ...
Source: Natural Product Research - October 21, 2021 Category: Biochemistry Authors: Akash Maurya Susheel Kumar Bijendra Kumar Singh Anand Kumar Chaudhari Abhishek Kumar Dwivedy Bhanu Prakash Nawal Kishore Dubey Source Type: research
Mechanistic investigations on antifungal and antiaflatoxigenic activities of chemically characterised < em > Carum carvi < /em > L. essential oil against fungal infestation and aflatoxin contamination of herbal raw materials
This study aimed to investigate the efficiency of chemically characterised Carum carvi essential oil (CcEO) against aflatoxin B1 (AFB1) producing strain of Aspergillus flavus (AF-LHP-WS-4) causing deterioration of herbal raw materials (HRM). GC-MS analysis of the EO revealed the presence of carvone (69.85%) as a dominant component. CcEO caused complete suppression of A. flavus growth and AFB1 secretion at 0.7 and 0.6 µL/mL, respectively. The investigation on antifungal mode of action showed that CcEO inhibited fungal growth via abrogating ergosterol biosynthesis and triggered efflux of vital cellular ions. The inhibition ...
Source: Natural Product Research - October 21, 2021 Category: Biochemistry Authors: Akash Maurya Susheel Kumar Bijendra Kumar Singh Anand Kumar Chaudhari Abhishek Kumar Dwivedy Bhanu Prakash Nawal Kishore Dubey Source Type: research
Leadership skills curriculum development for residents and fellows: A needs-assessment
Non-technical skills (NTS) curricula have demonstrated success in surgical residencies. The purpose of this study is to examine the need for a structured leadership curriculum at our institution. (Source: American Journal of Surgery)
Source: American Journal of Surgery - October 20, 2021 Category: Surgery Authors: Christopher Friendly, Camila Villacreses, Rupak Mukherjee, Ellen Babilon, Julie Caraway, Sean Dieffenbaugher, Ashley Hink, John Mellinger, Leah Plumblee, Megan Walters, Cynthia Talley Source Type: research
Anti-Inflammatory and Antimicrobial Volatile Oils: Fennel and Cumin Inhibit Neutrophilic Inflammation via Regulating Calcium and MAPKs
Neutrophilic inflammatory diseases, such as chronic obstructive pulmonary disease (COPD), acute respiratory distress syndrome (ARDS), or psoriasis, exert a huge burden on the global health system due to the lack of safe and effective treatments. Volatile oils from terrestrial plants showed impressive therapeutic effects against disorders of the skin, digestive system, lungs, liver, metabolism, and nervous system. However, their effect on the immune system and neutrophil function is still elusive. Fennel, cumin, marjoram, lavender, caraway, and anise are the common nutraceuticals that are widely used in the Mediterranean di...
Source: Frontiers in Pharmacology - October 11, 2021 Category: Drugs & Pharmacology Source Type: research
Characterization, Biological Activity, and Mechanism of Action of a Plant-Based Novel Antifungal Peptide, Cc-AFP1, Isolated From Carum carvi
In this study, a novel AFP, Cc-AFP1, with a molecular weight of ~3.759 kDa, was isolated from Carum carvi L., purified by ammonium sulfate precipitation and reversed-phase HPLC and finally identified by sequence analysis using Edman degradation. Peptide sequence analysis revealed a fragment of 36 amino acid residues as RVCFRPVAPYLGVGVSGAVRDQIGVKLGSVYKGPRG for Cc-AFP1 with a net charge of +5 and a hydrophobicity ratio of 38%. The antifungal activity of Cc-AFP1 was confirmed against Aspergillus species with MIC values in the range of 8–16 µg/ml. Cc-AFP1 had less than 5% hemolytic activity at 8–16 µg/ml on human red blo...
Source: Frontiers in cellular and infection microbiology - September 29, 2021 Category: Microbiology Source Type: research
Microencapsulated Caraway Essential Oil Affects Initial Growth of Maize Cultivars
Molecules. 2021 Aug 20;26(16):5059. doi: 10.3390/molecules26165059.ABSTRACTCaraway (Carum carvi L.) essential oil is a candidate for botanical herbicides. A hypothesis was formulated that the sand-applied maltodextrin-coated caraway oil (MCEO) does not affect the growth of maize (Zea mays L.). In the pot experiment, pre-emergence application of five doses of MCEO was tested on four maize cultivars up to the three-leaf growth stage. The morphological analyses were supported by the measurements of relative chlorophyll content (SPAD), two parameters of chlorophyll a fluorescence, e.g., Fv/Fm and Fv/F0, and fluorescence emissi...
Source: JOP - August 27, 2021 Category: Gastroenterology Authors: Katarzyna Mo żdżeń Agnieszka Krajewska Jan Bocianowski Beata Jop Agnieszka Synowiec Source Type: research
Microencapsulated Caraway Essential Oil Affects Initial Growth of Maize Cultivars
Molecules. 2021 Aug 20;26(16):5059. doi: 10.3390/molecules26165059.ABSTRACTCaraway (Carum carvi L.) essential oil is a candidate for botanical herbicides. A hypothesis was formulated that the sand-applied maltodextrin-coated caraway oil (MCEO) does not affect the growth of maize (Zea mays L.). In the pot experiment, pre-emergence application of five doses of MCEO was tested on four maize cultivars up to the three-leaf growth stage. The morphological analyses were supported by the measurements of relative chlorophyll content (SPAD), two parameters of chlorophyll a fluorescence, e.g., Fv/Fm and Fv/F0, and fluorescence emissi...
Source: JOP - August 27, 2021 Category: Gastroenterology Authors: Katarzyna Mo żdżeń Agnieszka Krajewska Jan Bocianowski Beata Jop Agnieszka Synowiec Source Type: research
Microencapsulated Caraway Essential Oil Affects Initial Growth of Maize Cultivars
Molecules. 2021 Aug 20;26(16):5059. doi: 10.3390/molecules26165059.ABSTRACTCaraway (Carum carvi L.) essential oil is a candidate for botanical herbicides. A hypothesis was formulated that the sand-applied maltodextrin-coated caraway oil (MCEO) does not affect the growth of maize (Zea mays L.). In the pot experiment, pre-emergence application of five doses of MCEO was tested on four maize cultivars up to the three-leaf growth stage. The morphological analyses were supported by the measurements of relative chlorophyll content (SPAD), two parameters of chlorophyll a fluorescence, e.g., Fv/Fm and Fv/F0, and fluorescence emissi...
Source: JOP - August 27, 2021 Category: Gastroenterology Authors: Katarzyna Mo żdżeń Agnieszka Krajewska Jan Bocianowski Beata Jop Agnieszka Synowiec Source Type: research
Microencapsulated Caraway Essential Oil Affects Initial Growth of Maize Cultivars
Molecules. 2021 Aug 20;26(16):5059. doi: 10.3390/molecules26165059.ABSTRACTCaraway (Carum carvi L.) essential oil is a candidate for botanical herbicides. A hypothesis was formulated that the sand-applied maltodextrin-coated caraway oil (MCEO) does not affect the growth of maize (Zea mays L.). In the pot experiment, pre-emergence application of five doses of MCEO was tested on four maize cultivars up to the three-leaf growth stage. The morphological analyses were supported by the measurements of relative chlorophyll content (SPAD), two parameters of chlorophyll a fluorescence, e.g., Fv/Fm and Fv/F0, and fluorescence emissi...
Source: JOP - August 27, 2021 Category: Gastroenterology Authors: Katarzyna Mo żdżeń Agnieszka Krajewska Jan Bocianowski Beata Jop Agnieszka Synowiec Source Type: research
