Ventriculostomy related infection in intensive care unit: Dianostic criteria and related conditions
Conclusions CSF routine cultures and biochemical studies are not recommended to diagnose VRI. Clinical signs, external ventricular drain manipulation and a drainage insertion over a week justify the routine measurement of proteinorrachia, glycorrachia and the ratio of glycorrachia/glycemia. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research

Immunological study on integrated PilQ and disulphide loop region of PilA against acute Pseudomonas aeruginosa infection: In silico analysis and in vitro production
Conclusions We expect that the two recognized antigenic determinants from our chimeric protein, ‘‘AYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSG’’ and ‘‘GPIAGSCTFPTTGTSKSPSP’’, can be able to evoke strong both humoral and cell-mediated immune responses in mouse models. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research

Use of sodium polystyrene sulfonate in an acute-on-chronic lithium poisoned patient: A case report
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Chakroun-Walha Olfa, Ksibi Hichem, Rejeb Imen, Boujelben Mariem, Chaari Adel, Chtara Kamilia, Bouaziz Mounir, Rekik Noureddine A 35-year-old woman with an acute-on-chronic lithium overdose received multiple oral doses of sodium polystyrene sulfonate totaling 120 g over a 24-h period. During the 72 h after the institution of therapy, the serum lithium level decreased from 3.80 to 0.42 mEq/L. Multiple doses of sodium polystyrene sulfonate may be useful in lowering the serum lithium level in severely ill patients with acute ...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research

A case report of thyroid storm induced by acute sepsis
We reported a 40-year-old woman with thyroid goiter manifesting with acute sepsis-induced hyperthyroidism. She mainly presented with abdominal bloating, diarrhea, lower limbs edema and exertional dyspnea. The lactate was 9.5 mmol/L and procalcitonin was 3.8 ng/mL, suggesting acute sepsis. The thyroid echo showed bilateral thyroid goiter. Relevant data included a thyroid-stimulating hormone level of 0.03 μIU/mL; free tetraiodothyronine, 5.67 ng/dL; thyroid-stimulating hormone receptor antibody, 76.9% (normal range, < 14%); and antimicrosomal antibody titer, 1:102 400 (normal range, < 1:100), suggesting toxi...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research

Challenges in uncomplicated acute appendicitis
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Fernando Resende, Ana Beatriz Almeida, José Costa Maia, Renato Bessa Melo Acute appendicitis is one of the most common abdominal emergencies requiring surgery. It still represents, however, a challenging diagnosis. In order to facilitate this process, several scoring systems were developed, namely, the Alvarado score, acute inflammatory response and Raja Isteri Pengiran Anak Saleha Appendicitis scores, which are the most used in clinical practice. This clinical condition encompasses a wide spectrum of clinical presenta...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research

Emergency care outcomes of acute chemical poisoning cases in Rawalpindi
Conclusions Findings suggest that controlling access of poisonous substances in youth and at homes might reduce related ED care burden. Safety promotion agencies and emergency physicians can use these findings to develop safety messages. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Acute and sub-acute toxicity studies of aqueous and methanol extracts of Nelsonia campestris in rats
Conclusions Intake of high doses of this plant extracts may exhibit mild organ toxicity. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

A case of acute bilateral femur fracture with vascular injury
We present a case of unusual pattern of injury and fixation technique of bilateral proximal femur fracture associated with vascular injury, with very satisfied outcome. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Pathological research and acute hepatic and renal tissue damage in Wistar rats induced by cocoa
Conclusions The pattern of alanine aminotransferase activity being more active than aspartate aminotransferase one in serum appeared to correlate with the extent of disarrangement of hepatic tissue architecture. The experimental rat groups exhibited no hyperbilirubinemia. Also, diets containing processed cocoa bean and raw cocoa bean products did not substantially interfere with the capacity of the hepatocytes to biosynthesize plasma proteins and the functionality of renal tissues. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

A case of acute ischemic colitis after endovascular abdominal aortic aneurysm repair
We presented a case of ischemic colitis in a patient with patent hypogastric arteries that occurred after an endovascular abdominal aortic aneurysm repair as well as a review of the available literature. The patient's preoperative, intraoperative and postoperative data were recorded. A thorough search through the Google data and Medline to review similar cases or any analyses that referred to ischemic colitis after endovascular abdominal aneurysm repair was conducted. A 76 years old male was admitted to our department for an elective endovascular repair of an 8 cm sin diameter abdominal aortic aneurysm. A Zenith bifur...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Epidemiological study on acute cutaneous leishmaniasis in Morocco
Conclusions ZCL and ACL are still major health problems in Morocco. We highlight the spatiotemporal change of cutaneous leishmaniasis incidence through the country during the last ten years and we underline the correlation between ZCL incidence and the percentage of rural population in Morocco. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Contemporary management of acute kidney trauma
Publication date: Available online 9 October 2015 Source:Journal of Acute Disease Author(s): Inês Anselmo da Costa, Bastian Amend, Arnulf Stenzl, Jens Bedke Renal injury occurs in 1%–5% of all traumas, causing disability or even death. The American Association for the Surgery of Trauma (AAST) renal injury scale should be used when reporting these injuries. Although there is a consensus regarding handling of lower-grade injuries conservatively, the same cannot be said for the higher-grades, for which different specialists handle either conservatively or surgically. A search of the MEDLINE database was unde...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

An unusual case of acute wandering paralysis
Publication date: Available online 9 October 2015 Source:Journal of Acute Disease Author(s): Federico Bianchi, Quintino Giorgio D'Alessandris, Roberto Pallini, Eduardo Fernandez, Liverana Lauretti The authors reported on a 63-year-old diabetic male who developed a strange wandering hemiparesis affecting first left side and then right side, not consistent with a right parasagittal meningioma nor with ischemic stroke. The subsequent rapid worsening of clinical picture, with occurrence of paraparesis, urinary incontinence and midthoracic sensory level, together with the evidence of leucocytosis, led to the diagnosis of...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Pathological microRNAs in acute cardiovascular diseases and microRNA therapeutics
Publication date: Available online 9 October 2015 Source:Journal of Acute Disease Author(s): Syed Salman Ali, Chandra Kala, Mohd Abid, Nabeel Ahmad, Uma Shankar Sharma, Najam Ali Khan Cardiovascular diseases are one of the leading causes of morbidity and mortality. In recent researches, it is demonstrated that microRNAs (miRNAs) are expressed extensively in cardiovascular system and regulate gene expression in various cardiovascular diseases. Here, we are giving overview on number of miRNAs involved in pathophysiology of various cardiovascular diseases, and diagnostic and therapeutic potentials of miRNAs in these d...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Relation between blaTEM, blaSHV and blaCTX-M genes and acute urinary tract infections
Conclusions Due to the increase of E. coli with multiple ESBL genes, continuous surveillance in order to use appropriate antibiotics and the control of infections is necessary. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Acute ovarian torsion in young girls
Conclusions Ovarian torsion is a rare gynecological emergency in children which requires an early surgical intervention to save the ovary from necrosis. Unfortunately, surgical treatment was belated in all our patients. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Latest progress of research on acute abdominal injuries
Publication date: Available online 9 October 2015 Source:Journal of Acute Disease Author(s): Ionut Negoi, Sorin Paun, Bogdan Stoica, Ioan Tanase, Mihaela Vartic, Ruxandra Irina Negoi, Sorin Hostiuc, Mircea Beuran Major abdominal trauma, both blunt and penetrating, is commonly seen nowadays, being particularly difficult to manage due to the frequent altered mental status of the patients and severity of associated injuries. The review article aims to make an uptodate study of the current strategies for therapeutic approach of abdominal injuries in polytrauma setting. Review of the medical literature is up to 2015, ...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

Relation between acute kidney injury and pregnancy-related factors
This article aims to review current studies with regards to obstetrics related AKI. Most of the studies in this review were carried out in observational, both prospective and retrospective, studies. Results demonstrated a variety of major PRAKI causes such as hypertensive disorders in pregnancy, obstetric hemorrhage, sepsis, thrombotic microangiopathy and acute fatty liver in pregnancy. Aside from awareness of the etiologies of PRAKI, understanding the physiological renal adaptation during pregnancy is crucial for early detection, diagnosis, and proper management to prevent the obstetric complications. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

A review of main controversial aspects of acute testicular torsion
We present a comprehensive review of TT, including the aetiology, risk factors, diagnosis, treatment and outcome, based on recently published articles. The novel and the major controversial aspects of this topic are highlighted. The PubMed and ScienceDirect databases were searched with the following keywords: TT, torsion of the spermatic cord and acute scrotum, particular stress being placed on articles published in the last 5 years. The genetic aspects of TT are discussed, together with the diagnostic possibilities, such as sonography, radionuclide and fluorescent imaging techniques. The effective surgical techniques and ...
Source: Journal of Acute Disease - October 10, 2015 Category: Emergency Medicine Source Type: research

School safety and children health in a post-disaster community: Implications to collaborative care and service learning in school health
Conclusions One hundred and eighty-seven school-age children in two primary schools were involved in this study. Baseline data for children’s health status was obtained and the school health risks were identified. The findings suggested that it would be vital to develop collaborative care and service learning model to enhance children health and school safety in a disaster-prone community. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 4, 2015 Category: Emergency Medicine Source Type: research

Acute allergic reaction to oral quinine for malarial prevention: A case report
Publication date: Available online 4 October 2015 Source:Journal of Acute Disease Author(s): Sora Yasri, Viroj Wiwanitkit Quinine is a classical antimalarial drug that is used worldwide. It is also used for pre-exposure of malaria before visiting to the jungle in the endemic area of malaria. In this article, the authors reported a case of acute allergic reaction to oral quinine for malarial prevention. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - October 4, 2015 Category: Emergency Medicine Source Type: research

Research on garlic capsule and selenium-vitamin A, vitamin B, vitamin C applied in therapy of acute hepatocellular damage in a rat model
Conclusions Collectively, the results suggest that therapeutic dose of lisinopril elicits toxicity in male rats through induction of oxidative damage and depletion of cellular adenosine triphosphate. The reversal effects of GAR and SACE during lisinopril treatment suggest that these antioxidants may find clinical application in cellular damage involving ROS and adenosine triphosphate. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 19, 2015 Category: Emergency Medicine Source Type: research

Research on garlic capsule and selenium – Vitamin A, Vitamin C, Vitamin E applied in therapy of acute hepatocellular damage in a rat model
Conclusion Collectively, the results suggest that therapeutic dose of LIS elicits toxicity in male rats through induction of oxidative damage and depletion of cellular adenosine triphosphate (ATP). The reversal effects of GAR and SACE during LIS treatment suggest that these antioxidants may find clinical application in cellular damage involving reactive oxygen species (ROS) and ATP. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 14, 2015 Category: Emergency Medicine Source Type: research

Acute Mallory–Weiss syndrome after cardiopulmonary resuscitation by health care providers in the emergency department
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Dae Hee Kim, Dong Yoon Rhee, Seon Hee Woo, Woon Jeong Lee, Seung Hwan Seol, Won Jung Jeong A report of a 62-year-old female patient with severe Mallory–Weiss syndrome after successful cardiopulmonary resuscitation (CPR) by health care providers in the emergency department is presented. The bleeding continued for five days, and the patient's total blood loss was estimated to be approximately 3000 mL. After 7 days, the patient died due to respiratory distress syndrome. Severe Mallory–Weiss syndrome after CPR ma...
Source: Journal of Acute Disease - August 7, 2015 Category: Emergency Medicine Source Type: research

Research on garlic capsule and selenium- Vitamin A, Vitamin C, Vitamin E applied in therapy of acute hepatocellular damage in a rat model
Conclusion Collectively, the results suggest that therapeutic dose of LIS elicits toxicity in male rats through induction of oxidative damage and depletion of cellular adenosine triphosphate (ATP). The reversal effects of GAR and SACE during LIS treatment suggest that these antioxidants may find clinical application in cellular damage involving reactive oxygen species (ROS) and ATP. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 7, 2015 Category: Emergency Medicine Source Type: research

Risk factors for medical complications of acute hemorrhagic stroke
Conclusions Our study has assessed that hypertension followed by diabetes mellitus are the major risk factors for medical complications of hemorrhagic stroke. Female mortality rate was more when compared to males.\ (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 4, 2015 Category: Emergency Medicine Source Type: research

Early diagnostics and treatment with acute burn sepsis
Conclusions This in turn confirms the efficacy of early necrectomy and auto dermoplasty of deep burn wounds in victims with sepsis. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 4, 2015 Category: Emergency Medicine Source Type: research

Detection of neutrophil–lymphocyte ratio as a serum marker associated with inflammations by acute carbon monoxide poisoning
Conclusions The increase of NLR may indicate the progression of fatal complications due to CO poisoning. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - August 2, 2015 Category: Emergency Medicine Source Type: research

Evaluation of acute and subacute toxicity induced by methanol extract of Terminalia citrina leaves in Sprague Dawley rats
Conclusions It was safer and non toxic to rats even at higher doses and therefore could be well considered for further investigation for its medicinal and therapeutic efficacy. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Acute chest pain in a patient with a non-strangulated hiatal hernia
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Alexander John Scumpia, Megan Elizabeth Dekok, Daniel Michael Aronovich, Gurpaul Bajwa, Randy Barros, Randy Katz, Jordan Ditchek Acute chest pain resulting in spontaneous idiopathic hemomediastinum is a rare, potentially life-threatening occurrence. Acute chest pain is a common chief complaint of patients, accounting for 2.4%-6% of adult emergency room visits. The clinician’s differential diagnoses for acute chest pain rarely include complications of hiatal hernias. An 83-year-old male presented with acute chest pain a...
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

A case of acute spinal intradural hematoma due to spinal anesthesia
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Josué M. Avecillas-Chasín, Jordi A. Matias-Guiu, Gustavo Gomez, Javier Saceda-Gutierrez Spinal intradural hematoma is a rare complication of diagnostic lumbar puncture or spinal anesthesia. This complication could be overlooked with devastating neurological consequences due to a delay in diagnosis. Here, we reported a case of a patient with a lumbar spinal intradural hematoma as a result of a difficult spinal anesthesia. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Acute Mallory-Weiss syndrome after cardiopulmonary resuscitation by health care providers in the emergency department
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Dae Hee Kim, Dong Yoon Rhee, Seon Hee Woo, Woon Jeong Lee, Seung Hwan Seol, Won Jung Jeong A report of a 62-year-old female patient with severe Mallory-Weiss syndrome after successful cardiopulmonary resuscitation (CPR) by health care providers in the emergency department is presented. The bleeding continued for five days, and the patient’s total blood loss was estimated to be approximately 3 000 mL. After 7 days, the patient died due to respiratory distress syndrome. Severe Mallory-Weiss syndrome after CPR may occur an...
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Detection of neutrophil-lymphocyte ratio as a serum marker associated with inflammations by acute carbon monoxide poisoning
Conclusions The increase of NLR may indicate the progression of fatal complications due to CO poisoning. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Prevalence and epidemiologic profile of acute cutaneous leishmaniasis in an endemic focus, Southwestern Iran
Conclusions This study showed that the male sex and people under 20 years of age are mostly at risk. Therefore, education for groups at risk is very important. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Trauma pattern in a level I east-European trauma center
Conclusions Our trauma pattern profile is similar to the one found in west-European countries, with a predominance of traffic-related injuries and falls. The severity and anatomical puzzle for trauma lesions were more complex secondary to motorcycle or bicycle-to-auto vehicles collisions. A trauma registry, with prospective enrollment of patients, is a very effective tool for constant improvements in trauma care. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Acute viral hemorrhage disease: A summary on new viruses
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Somsri Wiwanitkit, Viroj Wiwanitkit Acute hemorrhagic disease is an important problem in medicine that can be seen in many countries, especially those in tropical world. There are many causes of acute hemorrhagic disease and the viral infection seems to be the common cause. The well-known infection is dengue, however, there are many new identified viruses that can cause acute hemorrhagic diseases. In this specific short review, the authors present and discuss on those new virus diseases that present as “acute hemorrhagic fe...
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Evaluation of the acute and sub-acute toxicity of the ethanolic extract of Pericampylus glaucus (Lam.) Merr. in BALB/c mice
Conclusions The result indicates that the oral administration of Pericampylus glaucus (Lam.) Merr. extract did not produce any significant toxic effect in BALB/c mice. Hence, the extract can be utilized safely for therapeutic use in pharmaceutical formulations. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Functional outcome of the surgical management of acute acetabular fractures
Conclusions Patients with displaced acetabular fractures should be referred to specialised centres. Early surgical intervention and experienced management is a prime factor in achieving good results. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Effects of geographic scale on population factors in acute disease diffusion analysis
Conclusions We concluded that variables at suitable spatial resolution may be useful in improving the predictive powers of models for disease outbreaks. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Emergent hybrid external fixation for tibial pilon fractures in adults
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Gabriele Falzarano, Antonio Medici, Predrag Grubor, Milan Grubor, Luigi Meccariello Objective To investigate that if the hybrid external fixation is the definitive treatment and management of tibial extra articular and intrarticulat pilon fractures of the adult in emergency. Methods We treated 237 cases of pilon fractures using hybrid external fixation with or without minimal osteosynthesis from February 1999 to December 2014. All fractures were classified according to the Association for the Study of Internal Fixation. The t...
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Acute band keratopathy formation after penetrating keratoplasty: A case report
Publication date: Available online 29 July 2015 Source:Journal of Acute Disease Author(s): Wee-Min Teh, Mohtar Ibrahim A 53-year-old male was referred from another eye hospital for right eye corneal perforation secondary to infective keratitis. A penetrating keratoplasty was performed for tectonic purposes. Fourty eight hours after penetrating keratoplasty, he developed a band keratopathy located at the interpalpebral area of the corneal button. Despite stopping topical and systemic ciprofloxacin which could have contributed to this, the band keratopathy became more severe. Surgical debridement of the band keratopathy ...
Source: Journal of Acute Disease - July 30, 2015 Category: Emergency Medicine Source Type: research

Obstetric anal sphincter injuries
Publication date: Available online 28 July 2015 Source:Journal of Acute Disease Author(s): Remon Keriakos, Deepa Gopinath Obstetric anal sphincter injuries can be associated with significant short and long term consequences causing devastating impacts on the quality of lives of young, otherwise healthy women. The major consequence is anal incontinence which may be short or long term and vary in severity. The other consequences include pain, infection, dyspareunia and sexual dysfunction. This may in turn result in considerable economic burden to health care providers and patients. It also has an implication on future de...
Source: Journal of Acute Disease - July 28, 2015 Category: Emergency Medicine Source Type: research

Methicillin-resistant Staphylococcus aureus: An occupational health hazard in the prehospital setting
Publication date: Available online 28 July 2015 Source:Journal of Acute Disease Author(s): Alaa Al Amiry Methicillin-resistant Staphylococcus aureus (MRSA) is a serious nosocomial infection within healthcare settings, and with its community version worldwide (i.e. community-acquired-MRSA), it is safe now to classify it as an epidemic. The aim of this paper is to build the logic for the reader to understand why this drug-resistant infection can impose an occupational hazard towards emergency health services personnel in the prehospital settings. This logic started with a model, the author conceptualizes as a cross-transm...
Source: Journal of Acute Disease - July 28, 2015 Category: Emergency Medicine Source Type: research

Advances in management of patients with acute diverticulitis
Conclusions Our cases and a careful review of the literature allowed us to develop a decision-making algorithm for patients with acute diverticulitis. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 28, 2015 Category: Emergency Medicine Source Type: research

Torsadogenic index for prevention of acute death
Publication date: Available online 28 July 2015 Source:Journal of Acute Disease Author(s): Adrián Ángel Inchauspe This risk management project aims to apply a global preventive and predictive measure in potential victims of acute death and heart failure. Among the main causes are identified sub-diagnosed genetic mutations; prescription, interaction, self-medication or abuse of suspected drugs due to internet prospects's consult; and a parasitic pandemia, the Chagas disease (over 100 000 000 population is potentially infected worldwide). Promoting a global extensive determination of the torsadogenic index w...
Source: Journal of Acute Disease - July 28, 2015 Category: Emergency Medicine Source Type: research

The trend of acute burns pre-hospital management
Conclusions Burn injuries are common in our settings, a more reason for all to know the immediate intervention to give to victims of such accidents. The kind of first aid administered to burns victims possibly affects the burns management outcome. Thus, the earlier the right intervention implemented, the lesser the complications. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 18, 2015 Category: Emergency Medicine Source Type: research

Progress on macrophage's proinflammatory products as markers of acute endometriosis
Publication date: Available online 10 July 2015 Source:Journal of Acute Disease Author(s): Alicja Ziętek, Konrad Futyma, Łukasz Nowakowski, Marek Gogacz, Tomasz Rechberger To provide the review of the macrophage activity products as pathophysiological markers of endometriosis by literature survey (PubMed, Cochrane). Immunoreactive cells and several of their synthesis products concentrations are elevated in the serum and peritoneal fluid in patients with endometriosis. The enhanced reactive proteins contributed to local inflammation and aggregation of endometriotic lesions. Immune response and immune surveillance o...
Source: Journal of Acute Disease - July 18, 2015 Category: Emergency Medicine Source Type: research

Therapeutic potential of bryophytes and derived compounds against cancer
Conclusions This review summarizes recent scientific findings and suggests further investigations to evaluate the cytotoxic efficacy of bryophytes. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 12, 2015 Category: Emergency Medicine Source Type: research

DPOAE measurements in comparison to audiometric measurements in hemodialyzed patients
Conclusions There is a sensorineural hearing loss observed in most of the patients with chronic renal failure. DPOAE audiogram shows lower amplitudes than impedance audiometry and it can be used for the early detection of cochlear damage. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 11, 2015 Category: Emergency Medicine Source Type: research

Successful application of acute cardiopulmonary resuscitation
Conclusions The scientific data obtained in this study suggest that an early response and therapy improves outcomes in CPR procedure. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - July 11, 2015 Category: Emergency Medicine Source Type: research