Immunological study on integrated PilQ and disulphide loop region of PilA against acute Pseudomonas aeruginosa infection: In silico analysis and in vitro production

Conclusions We expect that the two recognized antigenic determinants from our chimeric protein, ‘‘AYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSG’’ and ‘‘GPIAGSCTFPTTGTSKSPSP’’, can be able to evoke strong both humoral and cell-mediated immune responses in mouse models.
Source: Journal of Acute Disease - Category: Emergency Medicine Source Type: research

Related Links:

Publication date: Available online 17 January 2020Source: Veterinary ParasitologyAuthor(s): Pengfei Zhao, Yuncan Li, Yanqin Zhou, Junlong Zhao, Rui FangAbstractEimeria tenella, belonging to protozoon, is the causative agent of cecal coccidiosis in chicken and causes enormous impacts for poultry industry. The surface antigens of apicomplexan parasites function as attachment and invasion in host-parasite interaction. Meanwhile, host immune response is triggered as a result of parasitic invasion. Immunogenicity and potency as a vaccinal candidate antigen of E. tenella surface antigen 4 (EtSAG4) have been unknown. Therefore, a...
Source: Veterinary Parasitology - Category: Veterinary Research Source Type: research
Abstract From December 2006 to December 2016, 1093 human immunodeficiency virus (HIV) individuals
Source: J Korean Med Sci - Category: General Medicine Authors: Tags: J Korean Med Sci Source Type: research
At a time when almost everything is politicized, vaccination has planted itself squarely on the national stage, where a push and pull between science and skepticism is playing out in statehouses across the country.
Source: CNN.com - Health - Category: Consumer Health News Source Type: news
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
.
Source: Human Vaccines and Immunotherapeutics - Category: Allergy & Immunology Authors: Source Type: research
More News: Allergy & Immunology | Emergency Medicine | Genetics | Statistics | Study | Vaccines