Immunological study on integrated PilQ and disulphide loop region of PilA against acute Pseudomonas aeruginosa infection: In silico analysis and in vitro production
Conclusions We expect that the two recognized antigenic determinants from our chimeric protein, ‘‘AYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSG’’ and ‘‘GPIAGSCTFPTTGTSKSPSP’’, can be able to evoke strong both humoral and cell-mediated immune responses in mouse models.
Source: Journal of Acute Disease - Category: Emergency Medicine Source Type: research